Product Name: Anti-TSC22D4 (AB1) antibody produced in rabbit

Synonym: Anti-TSC22 domain family, member 4

Product Type: Chemical

CAS NO: 101043-37-2GPCR/G_protein_Compound_Library inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 41 kDa
NCBI accession no.
NP_112197
Shipped in: wet ice
species reactivity
guinea pig, rat, canine, human
Storage temp.: −20°C
Application: Rabbit Anti-TSC22D4 (AB1) antibody can be used for western blot (0.5μg/ml) applications.
General description: Liver TSC22D4 expression levels have been correlated to body weight loss and VLDL hypo-secretion in cancer cachexia. Moreover, studies have reported that TSC22D4 deficiency can rescue tumour cell-induced metabolic dysfunction in liver cells.
Rabbit Anti-TSC22D4 (AB1) antibody recognizes pig, and human TSC22D4.
Immunogen:
The immunogen for anti-TSC22D4 antibody: synthetic peptide derected towards the N terminal of human TSC22D4
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/649

Related Post