Product Name: Anti-MXD3 antibody produced in rabbit

Synonym: Anti-MAX dimerization protein 3

Product Type: Chemical

CAS NO: 108212-76-6Anti-virus_Compound_Library inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 23 kDa
NCBI accession no.
NP_112590
Shipped in: wet ice
species reactivity
human, rabbit, bovine, canine, mouse, horse, pig, rat
Storage temp.: −20°C
Application: Rabbit Anti-MXD3 antibody can be used for western blot (0.5μg/ml) applications.
General description: MXD3 is a basic, helix-loop-helix transcription factor that belongs to the MAD family of proteins. This protein is involved in cerebellar development and GNP proliferation. Studies have reported that MXD3 is also required for the proliferation of DAOY medulloblastoma cells.
Rabbit Anti-MXD3 antibody binds to human, bovine, canine, and mouse MXD3.
Immunogen:
The immunogen for anti-MXD3 antibody: synthetic peptide derected towards the N terminal of human MXD3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/600

Related Post