Product Name: Anti-TFAP2D antibody produced in rabbit

Synonym: Anti-Transcription factor AP-2 δ (activating enhancer binding protein 2 δ)

Product Type: Chemical

CAS NO: 58569-55-4Anti-cancer_Compound_Library inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 50 kDa
NCBI accession no.
NP_758438
Shipped in: wet ice
species reactivity
canine, rat, human, zebrafish, mouse, bovine, guinea pig, horse, rabbit
Storage temp.: −20°C
Application: Rabbit Anti-TFAP2D antibody can be used for western blot (2.5μg/ml) applications.
General description: Tfap2d codes for a transcription factor that belongs to the AP-2 family, called Ap-2delta. Tfap2d is known to be expressed during mouse embryogenesis.
Rabbit Anti-TFAP2D antibody interacts with canine, human, mouse, rat, zebrafish, chicken, and bovine TFAP2D.
Immunogen:
The immunogen for anti-TFAP2D antibody: synthetic peptide derected towards the C terminal of human TFAP2D
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/592

Related Post