Anti-TRH antibody produced in rabbit

Product Name: Anti-TRH antibody produced in rabbit

Synonym: Anti-MGC125964; Anti-MGC125965; Anti-Thyrotropin-releasing hormone

Product Type: Chemical

CAS NO: 474-58-8Syk inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 26 kDa
NCBI accession no.
NP_009048
Shipped in: wet ice
species reactivity
zebrafish, human, guinea pig, bovine
Storage temp.: −20°C
Application: Rabbit polyclonal anti-TRH antibody is used to tag thyrotrophin-releasing hormone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of thyrotrophin-releasing hormone in the regulation of the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. Anti-TRH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
General description: Rabbit polyclonal anti-TRH antibody reacts with zebrafish, human, canine, chicken, and bovine thyrotrophin-releasing hormones.
General description: Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. TRH is a highly specific regulator of the thyrotropin-stimulating hormone (TSHβ) gene expression in the pituitary via a nerve growth factor IB (NGFIB, NR4A1, Nur77)/PKC/ERK1/2 pathway.
Immunogen:
The immunogen for anti-TRH antibody: synthetic peptide derected towards the C terminal of human TRH
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/64