Product Name: Anti-CHRNA3 (AB2) antibody produced in rabbit

Synonym: Anti-Cholinergic receptor, nicotinic, α 3

Product Type: Chemical

CAS NO: 1000998-59-3Monoamine Oxidase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 57 kDa
NCBI accession no.
NP_000734
Shipped in: wet ice
species reactivity
human, guinea pig, rabbit, canine, bovine, mouse
Storage temp.: −20°C
Application: Rabbit polyclonal anti CHRNA3 antibody is used to tag cholinergic receptor, nicotinic, α3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of cholinergic receptor, nicotinic, α 3 in the function and specificity of neuronal nicotinic acetylcholine receptors. Anti-CHRNA3 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.625 μg/ml.
General description: Neuronal nicotinic acetylcholine receptors (nAChR) are homo- or heteropentameric complexes composed of homologous α and β subunits. Nicotinic acetylcholine receptors are broadly expressed in the nervous system where they help regulate processes such as excitability, neurotransmitter release and neuromuscular contraction. The specificity and function of various nAChRs is determined in part by their specific α and β subunits compositions. Neuronal acetylcholine receptor subunit α-3 (CHRNA3) is an important component of the nAChR component family.
General description: Rabbit polyclonal anti CHRNA3 antibody reacts with human and canine cholinergic receptor, nicotinic, α 3 subunits.
Immunogen:
The immunogen for anti-CHRNA3 antibody: synthetic peptide derected towards the N terminal of human CHRNA3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/202

Related Post