Product Name: Anti-CHRNB3 antibody produced in rabbit

Synonym: Anti-Cholinergic receptor, nicotinic, β 3

Product Type: Chemical

CAS NO: 141136-83-6Amyloid-(beta) inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_000740
Shipped in: wet ice
species reactivity
bovine, mouse, guinea pig, horse, rabbit, canine, rat
Storage temp.: −20°C
Application: Anti-CHRNB3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.03 μg/ml.
Biochem/physiol Actions:
CHRNB3 is a transmembrane oligomeric ligand-gated nicotinic receptor when activated by cholinergic binding induces ion channel opening for the movement of positive ions. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. High level expression of CHRNB3 has been observed in the substantia nigra, the ventral tegmental area (VTA), the locus coeruleus and the retina. CHRNB3 has been implicated in subjective responses to tobacco and alcohol consumption.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-CHRNB3 antibody: synthetic peptide derected towards the middle region of human CHRNB3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/185

Related Post