Anti-PAX2 antibody produced in rabbit

Product Name: Anti-PAX2 antibody produced in rabbit

Synonym: Anti-Paired box gene 2

Product Type: Chemical

CAS NO: 364071-16-9P2X Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_000269
species reactivity
zebrafish, mouse, sheep, bovine, human, canine, rat, guinea pig, rabbit
Storage temp.: −20°C
Application: Rabbit polyclonal anti-PAX2 antibody is used to tag paired box gene 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of paired box gene 2 in pro- and mesonephros development and HER2 expression in breast cancers. PAX2 is a marker in differentiating diffuse malignant mesotheliomas of peritoneum (DPMM) from serous carcinomas of müllerian origin. Anti-PAX2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
General description: Paired box (PAX) genes are tissue specific homeodomain transcription factors involved in fetal and early animal tissue and cell specification and processes such as limb regeneration. Paired box gene 2 (PAX2) is involved in kidney nephron differentiation and branching morphogenesis of the metanephros. PAX2 and PAX8 are essential for the initiation of pro- and mesonephros development. PAX2 is involved in the regulation of ERBB2/HER2 transcription in breast cancer cells.
Immunogen:
The immunogen for anti-PAX2 antibody: synthetic peptide derected towards the middle region of human PAX2
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS
Specificity:
Rabbit polyclonal anti-PAX2 antibody reacts with human, mouse, rat, zebrafish, and chicken paired box gene 2 transcription factors.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/1019