Product Name: Anti-TFEB (AB1) antibody produced in rabbit

Synonym: Anti-Transcription factor EB

Product Type: Chemical

CAS NO: 122628-50-6MEK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_009093
species reactivity
human, goat, canine, guinea pig, mouse, rabbit, rabbit, bovine, horse, pig, rat
Storage temp.: −20°C
Application: Rabbit polyclonal anti-TFEB antibody is used to tag transcription factor EB for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of transcription factor EB in lysosomal biogenesis, autophagy and humoral immunity. Anti-TFEB (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
TFEB interacts with mTORC1 signaling and stimulates the genes involved in lysosomal biogenesis. TFEB promotes lysosomal exocytosis and removal of autophagolysosomes in muscle fibers.
General description: Rabbit polyclonal anti-TFEB antibody reacts with chicken, rabbit, human, mouse, and rat transcription factor EB transcription factors.
General description: Transcription factor EB (TFEB), a basic Helix-Loop-Helix-Zipper family of transcription factor, is the master regulator of lysosomal biogenesis that links lysosomal biogenesis with autophagy, a process that involves the degradation of a cells own proteins. TFEB is an important regulatory factor for CD40 ligand expression by activated CD4(+) T cells and thymus-dependent humoral immunity.
Immunogen:
The immunogen for anti-TFEB antibody: synthetic peptide derected towards the middle region of human TFEB
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/564

Related Post