Product Name: Anti-CTCF (AB2) antibody produced in rabbit

Synonym: Anti-CCCTC-binding factor (Zinc finger protein)

Product Type: Chemical

CAS NO: 313348-27-5IRAK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 83 kDa
NCBI accession no.
NP_006556
Shipped in: wet ice
species reactivity
horse, rabbit, human, rat, mouse, bovine, canine
Storage temp.: −20°C
Application: Anti-CTCF (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
CTCF is a nuclear protein that is important for regulation of V(D)J recombination in B and T cells. It is a critical regulator of long-range chromatin interactions and chromatin looping. It mediates the conFormational changes during immunoglobulin and T cell receptor rearrangements. CTCF also has roles in embryonic, hematopoietic and neuronal development and oncogene activation.
Immunogen:
The immunogen for anti-CTCF antibody: synthetic peptide derected towards the N terminal of human CTCF
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/448

Related Post