Product Name: Anti-RBX1 antibody produced in rabbit

Synonym: Anti-Ring-box 1

Product Type: Chemical

CAS NO: 221877-54-9Kinesin inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 12 kDa
NCBI accession no.
NP_055063
Shipped in: wet ice
species reactivity
mouse, guinea pig, canine, human, bovine, zebrafish, rat
Storage temp.: −20°C
Application: Anti-RBX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
RBX1 is a component of SCF E3 ubiquitin ligase and participates in tagging and degradation of various substrates in the cell to maintain homeostasis. It is crucial in meiotic maturation process of mouse oocytes. RBX1 is essential maintaining the integrity of genome and for development and viability in C. elegans.
Immunogen:
The immunogen for anti-RBX1 antibody: synthetic peptide derected towards the middle region of human RBX1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/918

Related Post