Product Name: Anti-CDK7 antibody produced in rabbit

Synonym: Anti-Cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase)

Product Type: Chemical

CAS NO: 307538-42-7DNA_RNA Synthesis inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_001790
Shipped in: wet ice
species reactivity
guinea pig, pig, human, canine, horse, rat, bovine, mouse
Storage temp.: −20°C
Application: Anti-CDK7 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
Cyclin-dependent kinase7 (Cdk7) is the only known CDK-activating kinase in metazoans. It associates with cyclin H and the complex regulates RNA polymerase and transcription in several species. CDK7 regulates the transcription machinery required for larval development of zebrafish.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-CDK7 antibody: synthetic peptide derected towards the C terminal of human CDK7
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/851

Related Post