Product Name: PrEST Antigen SEPT1Synonym: DIFF6; PNUTL3Product Type: ChemicalCAS NO: 516-54-1HIV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000180096Form: buffered aqueous solutionImmunogen sequence: EVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKMol wt: predicted mol…
Product Name: PrEST Antigen DDX28Synonym: FLJ11282; MDDX28Product Type: ChemicalCAS NO: 1617495-03-0HBV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000182810form: buffered aqueous solutionImmunogen sequence: TLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKMol wt: predicted mol…
Product Name: PrEST Antigen CMTR2Synonym: AFT; FLJ11171; MTr2Product Type: ChemicalCAS NO: 19309-14-9Filovirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000180917Form: buffered aqueous solutionImmunogen sequence: DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCHMol wt: redicted…
Product Name: PrEST Antigen IST1 Synonym: KIAA0174 Product Type: Chemical CAS NO: 146062-49-9Bacterial inhibitors Assay: >80% (SDS-PAGE) Concentration: ≥0.5 mg/mL Conjugate: His tagged Ensembl | human accession no.: ENSG00000182149 Form: buffered…
Product Name: PrEST Antigen ANKS4B Synonym: FLJ38819; HARP Product Type: Chemical CAS NO: 864677-55-4Anti-infection inhibitors Assay: >80% (SDS-PAGE) Concentration: ≥0.5 mg/mL Conjugate: His tagged Ensembl | Cuman accession no.: ENSG00000175311 Form:…
d to be overexpressed in a variety of human cancer cell lines and ectopic overexpression of Aurora-C can also induce cell transformation and tumor formation. However, its expression in tumor…
er, the order of these subsequent compositional changes remains unclear. A number of studies including very recent single molecule studies in yeast, indicate that the recruitment of the NTC occurs…
In grey lowercase. (D) As one estimate of the significance level for apparent shifts between constructs, normalized expression values were compared by ANOVA, followed by Tukey's Honest 10781694 Significant Differences…
Arabinose. V52 and the isogenic vasK mutant were used as positive and negative controls, respectively. Pellets and culture supernatants were separated by centrifugation. The supernatant portions were concentrated by TCA…
N ``OneSiteBind'' model Y = Bmax 6 X/(Kd + X). Y represents the percentage of bound ligand in the total amount of ligand, and X represents the concentration of NK1R-NLPs…