Product Name: PrEST Antigen SCN9A

Synonym: ETHA; NE-NA; NENA; Nav1.7; PN1

Product Type: Chemical

CAS NO: 1350514-68-9PPAR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000169432
Form: buffered aqueous solution
Immunogen sequence: RAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNENSSP
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q15858
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SCN9AwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA061843.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/317/1/53

Related Post