Product Name: Anti-TFDP1 antibody produced in rabbit

Synonym: Anti-Transcription factor Dp-1

Product Type: Chemical

CAS NO: 1432908-05-8Calcium Channel inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_009042
Shipped in: wet ice
species reactivity
human, mouse, bovine
Storage temp.: −20°C
Application: Anti-TFDP1 antibody produced in rabbit is suitable for western blotting at a concentration of 2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
TFDP1 heterodimerizes with members of E2F transcription factor family to activate or repress the E2F target genes. The E2F/DP1 complex regulates cellular processes such as cell cycle, apoptosis and oncogenic transFormation. Overexpression of TFDP1 may promote the growth of hepatocellular carcinoma cells.
Immunogen:
The immunogen for anti-TFDP1 antibody: synthetic peptide derected towards the N terminal of human TFDP1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/610

Related Post