Product Name: Anti-TCF12 (AB2) antibody produced in rabbit

Synonym: Anti-HEB; Anti-HTF4; Anti-HsT17266; Anti-Transcription factor 12 (HTF4, helix-loop-helix Transcription factors 4)

Product Type: Chemical

CAS NO: 912806-16-7PGE synthase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 73 kDa
NCBI accession no.
NP_003196
Shipped in: wet ice
species reactivity
pig, zebrafish, human, mouse, bovine
Storage temp.: −20°C
Application: Anti-TCF12 (AB2) antibody produced in rabbit rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
TCF12 suppresses the expression of E-cadherin mRNA in metastatic colorectal cancer cells. The overexpression of TCF12 facilitates cell migration and invasion of these cells. TCF12 has a possible role in maintaining neural stem cells and progenitor cells in undifferentiated state during neurogenesis.
General description: TCF12 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.
Immunogen:
The immunogen for anti-TCF12 antibody: synthetic peptide derected towards the N terminal of human TCF12
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/478

Related Post