Product Name: Anti-RELA antibody produced in rabbit

MDL Number: MFCD00802848
Product Type: Chemical

CAS NO: 821768-06-3Toll-like Receptor (TLR) inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 60 kDa
NCBI accession no.
NP_068810
Shipped in: wet ice
species reactivity
mouse, bovine, rat, canine, zebrafish, horse, human, guinea pig
Storage temp.: −20°C
Application: Anti-RELA antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
RelA is a subunit of NF-κB transcription factor complex and collaborates with another subunit called p50. RelA/p50 complex is crucial in induction and regulation of a wide range of genes involved in inflammation, immune responses, cell differentiation, organ Formation and apoptosis.
Immunogen:
The immunogen for anti-RELA antibody: synthetic peptide derected towards the N terminal of human RELA
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/516

Related Post