Product Name: Anti-NR2C1 antibody produced in rabbit

Synonym: Anti-Nuclear receptor subfamily 2, group C, member 1

Product Type: Chemical

CAS NO: 71939-50-9Ribosomal S6 Kinase (RSK) inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 67 kDa
NCBI accession no.
NP_003288
Shipped in: wet ice
species reactivity
horse, pig, human, canine, bovine, guinea pig, rabbit, rat, mouse
Storage temp.: −20°C
Application: Anti-NR2C1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
NR2C1 (TR4) is an orphan nuclear receptor that heterodimerizes with closely related family members to activate target gene expression. The target genes are involved in RNA metabolism and protein synthesis across various cell types.
Immunogen:
The immunogen for anti-NR2C1 antibody: synthetic peptide derected towards the C terminal of human NR2C1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QEKAYVEFQDYITKTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLI
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/588

Related Post