Product Name: Anti-IRF8 antibody produced in rabbit

Synonym: Anti-Interferon regulatory factor 8

Product Type: Chemical

CAS NO: 127917-66-2Na(addition)_HCO3- Cotransporter inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 48 kDa
NCBI accession no.
NP_002154
Shipped in: wet ice
species reactivity
human, rat, canine, horse, bovine, guinea pig, rabbit, zebrafish, mouse
Storage temp.: −20°C
Application: Anti-IRF8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
IRF-8 regulates the activity of myocardin and modulates the phenotype of smooth muscle cells. It regulates the development and function of T cells, B cells and macrophages. IRF-8 induces the production of type 1 interferons in dendritic cells.
General description: Interferon regulatory factors are transcription factors that regulate the expression of interferon system. The activity of IRF-8 has been implicated in vascular diseases.
Immunogen:
The immunogen for anti-IRF8 antibody: synthetic peptide derected towards the N terminal of human IRF8
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3.cover-expansion

Related Post