Product Name: Anti-HES7 antibody produced in rabbit

Synonym: Anti-Hairy and enhancer of split 7 (Drosophila)

Product Type: Chemical

CAS NO: 415903-37-6Vitamin D Related inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 25 kDa
NCBI accession no.
NP_115969
Shipped in: wet ice
species reactivity
canine, rat, rabbit, mouse, bovine, guinea pig, human, horse
Storage temp.: −20°C
Application: Anti-HES7 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
Hes7 is a bHLH factor that is essential for somitogenesis and regulation of segmentation clock in collaboration with Notch signaling.
Immunogen:
The immunogen for anti-HES7 antibody: synthetic peptide derected towards the middle region of human HES7
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/469

Related Post