Product Name: Anti-GTF2H1 antibody produced in rabbit

Synonym: Anti-General transcription factor IIH, polypeptide 1, 62 kDa

Product Type: Chemical

CAS NO: 529-53-3Raf inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 62 kDa
NCBI accession no.
NP_001135779
Shipped in: wet ice
species reactivity
guinea pig, mouse, horse, human, zebrafish, rat
Storage temp.: −20°C
Application: Anti-GTF2H1 antibody is suitable for western blotting at a concentration of 1-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
GTF2H1 is RNA polymerase II basal transcription factor that is involved in DNA repair, transcription elongation and cell cycle.
Immunogen:
The immunogen for anti-GTF2H1 antibody: synthetic peptide derected towards the N terminal of human GTF2H1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/579

Related Post