Product Name: Anti-GABRP antibody produced in rabbit

Synonym: Anti-γ-Aminobutyric acid (GABA) A receptor, pi; Anti-MGC126386; Anti-MGC126387

Product Type: Chemical

CAS NO: PI3K_Akt_mTOR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 51 kDa
NCBI accession no.
NP_055026
Shipped in: wet ice
species reactivity
horse, human, rat, rabbit, canine, mouse
Storage temp.: −20°C
Application: Anti-GABRP antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
GABRP is a subunit of GABAA receptor, the main inhibitory receptor in the brain. GABAA receptors in mouse taste buds inhibit the secretion of ATP from receptor cells during taste stimulation and are important for growth and differentiation of taste buds.
Immunogen:
The immunogen for anti-GABRP antibody: synthetic peptide derected towards the N terminal of human GABRP
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/241

Related Post