Product Name: Anti-EIF2AK2 antibody produced in rabbit

Synonym: Anti-Eukaryotic translation initiation factor 2-α kinase 2

Product Type: Chemical

CAS NO: 38101-59-6CGRP Receptor inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 62 kDa
NCBI accession no.
NP_001129123
Shipped in: wet ice
species reactivity
human
Storage temp.: −20°C
Application: Anti-EIF2AK2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.125 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
EIF2AK2 is a member of serine-threonine eIF2α kinase family. It is a dsRNA-dependent protein kinase activated by dsRNA during viral infections. EIF2AK2 is an important component of antiviral immune response system.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-EIF2AK2 antibody: synthetic peptide derected towards the C terminal of human EIF2AK2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: IISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/249

Related Post