Product Name: Anti-EGR2 antibody produced in rabbit

Synonym: Anti-CMT1D; Anti-CMT4E; Anti-DKFZp686J1957; Anti-Early growth response 2 (Krox-20 homolog, Drosophila); Anti-FLJ14547; Anti-KROX20

Product Type: Chemical

CAS NO: 144217-65-2Metabolic Enzyme_Protease inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Mol wt: mol wt 50 kDa
NCBI accession no.
NP_000390
packaging
pkg of 100 μL buffered aqueous solution

pkg of 50 μg lyophilized powder
species reactivity
human, canine, rabbit, horse, bovine, pig, mouse, rat
Storage temp.: −20°C
Application: Rabbit polyclonal anti-EGR2 antibody is used to tag early growth response 2 factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of early growth response 2 factor in cell processes such as differentiation (osteoclast), tissue (brain) patterning, and apoptosis. Anti-EGR2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
General description: Early growth response (EGR) proteins are transcriptional regulators (EGR1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 2 (EGR2, Krox20, CMT1D, CMT4E), a C2H2-type zinc-finger protein, regulates a wide spectrum of cellular responses including differentiation (osteoclast), tissue (brain) patterning, and apoptosis.
Immunogen:
The immunogen for anti-EGR2 antibody: synthetic peptide derected towards the C terminal of human EGR2
Sequence:
Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
Specificity:
Rabbit polyclonal anti-EGR2 antibody reacts with zebrafish, canine, human, mouse, rat, and pig early growth response 2 factors.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/708

Related Post