Product Name: Anti-CHRNA9 antibody produced in rabbit

Synonym: Anti-Cholinergic receptor, nicotinic, α-9 (muscle)

Product Type: Chemical

CAS NO: 1627710-50-2Tyrosinase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 55 kDa
NCBI accession no.
NP_060051
Shipped in: wet ice
species reactivity
horse, guinea pig, rabbit, zebrafish, mouse, bovine, canine
Storage temp.: −20°C
Application: Anti-CHRNA9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0625 μg/ml.
Biochem/physiol Actions:
CHRNA9 is a transmembrane oligomeric ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. The expression of CHRNA9 receptor has been observed to be elevated in human breast epithelial cells during tumorigenesis. CHRNA9 has been implicated in stress-induced functional plasticity of rat adrenal medulla.
Immunogen:
The immunogen for anti-CHRNA9 antibody: synthetic peptide derected towards the N terminal of human CHRNA9
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/169

Related Post