Product Name: Anti-CCR8 antibody produced in rabbit

Synonym: Anti-Chemokine (C-C motif) receptor 8

Product Type: Chemical

CAS NO: 312271-03-7Glucagon Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 41 kDa
NCBI accession no.
NP_005192
Shipped in: wet ice
species reactivity
human, bovine, rabbit
Storage temp.: −20°C
Application: Anti-CCR8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
CCR8 is a mammalian ligand for the chemokine CCL1 and plays an important role in recruitment of T cells and eosinophils in asthma and atopic dermatitis. The role of CCR8 in disease progression has been demonstrated in type I diabetes and autoimmune encephalomyelitis.
Immunogen:
The immunogen for anti-CCR8 antibody: synthetic peptide derected towards the middle region of human CCR8
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/294

Related Post