Anti-CASP3 antibody produced in rabbit

Product Name: Anti-CASP3 antibody produced in rabbit

Synonym: Anti-Caspase 3, apoptosis-related cysteine peptidase

Product Type: Chemical

CAS NO: 38916-34-6Antibody-drug Conjugate_ADC Related inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 32 kDa
NCBI accession no.
NP_116786
Shipped in: wet ice
species reactivity
rat, rabbit, bovine, canine, horse, human, guinea pig, pig
Storage temp.: −20°C
Application: Rabbit Anti-CASP3 antibody can be used for western blot applications at 5μg/ml.
General description: CASP3 is an important regulator of apoptosis. Studies have reported that CASP3 is occasionally altered in human cancers. Rabbit Anti-CASP3 antibody binds to rat, rabbit, bovine, canine, human, and pig CASP3.
Immunogen:
The immunogen for anti-CASP3 antibody: synthetic peptide derected towards the N terminal of human CASP3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/602